PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g003230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31751.1 Da    PI: 8.326
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g003230.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33.1e-19113167256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tk+q  +Lee F+++++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  Sopen08g003230.1 113 RKKLRLTKDQSVVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTK 167
                       788899***********************************************98 PP

2HD-ZIP_I/II127.36.5e-41113202191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rl+k+q+ +LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL+kev+eLr +l
  Sopen08g003230.1 113 RKKLRLTKDQSVVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCENLTEENRRLQKEVQELR-AL 202
                       69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.6E-16185IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.17E-18105170IPR009057Homeodomain-like
PROSITE profilePS5007117.54109169IPR001356Homeobox domain
SMARTSM003891.5E-16111173IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-18113167IPR009057Homeodomain-like
PfamPF000461.2E-16113167IPR001356Homeobox domain
CDDcd000861.08E-14113170No hitNo description
PRINTSPR000311.3E-5140149IPR000047Helix-turn-helix motif
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5149165IPR000047Helix-turn-helix motif
PfamPF021834.9E-11169203IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-26169212IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MLENQDLRLS LSLSFSENKT TNPLQLNSWI GSFPSSDRNL EKCRTYLKGI DVNIIPTNTE  60
EEEVGVSSPN SSISSLSGNK RNEREIINCC DELEIERECS RSISDEEDGE TSRKKLRLTK  120
DQSVVLEESF KEHNTLNPKQ KQALAKRLGL RPRQVEVWFQ NRRARTKLKQ TEVDCELLKR  180
CCENLTEENR RLQKEVQELR ALKLSPQLYM QMTPPTTLTM CPSCERVVGP PPVSASGPAS  240
IDIRANQMVL ARQRPVPFNL WTASPVPHRP INTLHPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117SRKKLRL
2161169RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083858.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466003e-92HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLM1AXL41e-179M1AXL4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000325461e-179(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.17e-88homeobox protein 2